PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11884_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 459aa    MW: 50690.9 Da    PI: 5.9975
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11884_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.31.1e-074044372154
                                           HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                              Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                           k +yp++e++++L +++gL+ +q+ +WF N+R +
  cra_locus_11884_iso_3_len_2216_ver_3 404 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 437
                                           469*****************************87 PP

2ELK26.61.3e-09358379122
                                   ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                           ELK++L+++Y+++++++++E++
  cra_locus_11884_iso_3_len_2216_ver_3 358 ELKRELKQGYKEKIVDIREEIL 379
                                           9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.6E-19193237IPR005540KNOX1
PfamPF037901.2E-17196236IPR005540KNOX1
SMARTSM012562.4E-29246301IPR005541KNOX2
PfamPF037913.8E-21250300IPR005541KNOX2
PfamPF037894.5E-6358379IPR005539ELK domain
PROSITE profilePS512139.917358378IPR005539ELK domain
SMARTSM011880.0017358379IPR005539ELK domain
PROSITE profilePS5007111.726378441IPR001356Homeobox domain
SMARTSM003892.4E-11380445IPR001356Homeobox domain
SuperFamilySSF466894.15E-16380444IPR009057Homeodomain-like
CDDcd000868.62E-12381442No hitNo description
Gene3DG3DSA:1.10.10.603.3E-25385442IPR009057Homeodomain-like
PfamPF059201.3E-17398437IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MAFPNHFSQE MALQHFSDHH LGDNSSVLPT ILPQHLPHSS PDGKTPDAQL HAPPPPPTWL  60
NSAILRQQAQ YSGPTAPGAT GGDANFLNLH TNSDSSAAAS QASNQWLSRS ILQRNVSDVR  120
DDVQVSNDSM IAAAISHESA ADLNNNNNNN TNNNNDNTTS NRNNGGELTE NEVAGGGGPT  180
AAGGDGAMNW QNARHKAEIL SHPLYEQLLS AHVACLRIAT PVDQLPRIDA QLAQSQHVVA  240
KYSALTHVNL GDDKELDQFM THYVLLLCSF KEQLQQHVRV HAMEAVMACW EIEQSLQSLT  300
GVSPGEGTGA TMSDDDDDQV DSDANLFDGS LDDPDSMGFG PLIPTESERS LMERVRQELK  360
RELKQGYKEK IVDIREEILR KRRAGKLPGD TTSVLKAWWQ SHSKWPYPTE EDKARLVQET  420
GLQLKQINNW FINQRKRNWH SNPSSSTASK SKRKRYAIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12381445872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1434454RKRNWHSNPSSSTASKSKRKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010265707.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X3
SwissprotP480000.0KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A103XGI50.0A0A103XGI5_CYNCS; ELK-like protein
STRINGVIT_04s0008g06130.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14322472